PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000291G1250
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family Nin-like
Protein Properties Length: 937aa    MW: 102182 Da    PI: 5.8043
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000291G1250genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.85.2e-29589640152
           RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                      aek+isle+l++yFs+++k+AAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  PH01000291G1250 589 AEKTISLEVLQQYFSGSLKNAAKSLGVCPTTMKRICRQHGISRWPSRKINKV 640
                      589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.496579660IPR003035RWP-RK domain
PfamPF020423.3E-26592640IPR003035RWP-RK domain
SuperFamilySSF542773.92E-20832926No hitNo description
Gene3DG3DSA:3.10.20.2401.7E-24842923No hitNo description
PROSITE profilePS5174518.789842924IPR000270PB1 domain
SMARTSM006662.4E-24842924IPR000270PB1 domain
PfamPF005646.4E-15842923IPR000270PB1 domain
CDDcd064071.06E-31843923No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 937 aa     Download sequence    Send to blast
MDLDPPSSSA AAAGGDGGGG GDVWPFDSFT TSLFFSSVSA SPPLPAASSS WLTPPSPLWL  60
FDDRQLLPLE VGPAPAVAAP EAVVAAVVAE EVHRTLSGNS DTTSKRVKQI NSKWQFHLSL  120
DDDSTDSACL FKERITQALR YFKESTDQHL LVQVWAPVKN GDRFVLTTSG QPFVLDHQSI  180
GLLQYRAVSM MYMFSVDGDN AGELGLPGRV YKQKVPEWTP NVQYYSSTEY PRLNHAISYN  240
VHGTVALPVF DPSVQSCIAV VELIMTSKKI NYACEVDKVC KALEAVNLKS TEILDHPNVQ  300
ICNEGRQSAL VEILEILTVV CEEHKLPLAQ TWVPCKYRNV LAHGGGVKSC LSFDGSCMGE  360
VCMSTSDVAF HVIDAHMWGF RDACVEHHLQ KGQGVSGKAF IYRRPCFSKD ISQFCKFEYP  420
LVHYARMFGL AGCFAICLQS SYTGNDDYIL EFFLPPSCRD EYDQNALLES ILVLMKQCLR  480
SLKVVGNGDS NEASLQISNV LIIENEDFET NVHFENSEGC LCESPEGDTH GGVHEFDKGN  540
IKVSERCLLA DDNSQNNGTS VSKPNGSGAS DSSLLHKNNK PPERRRGKAE KTISLEVLQQ  600
YFSGSLKNAA KSLGVCPTTM KRICRQHGIS RWPSRKINKV NRSLSKLKLV IESVQGSDAA  660
FNLTSITGPL PIPVGPSSDS LNIEKASQSK VAELSNPAVD GDRDSSLQKS LENGSHFGIL  720
MSQQGFIDNN NHVQLEADKA SHSRSSSGEG SINSHTSEGS CQGSPANQTF ICNPIASTFL  780
EPQSNPEVFT KEPFQESELP LSRMLIEDSG SSKDLKNLFT SAVDRPILAP PSNLVPVQNS  840
GTVTIKASFK EDIVRFRFPC SGSVSVLKDE VAKRLRMDVG MFHIKYLDDD HEWVKLACNA  900
DLEECMEISR HSGSHVIRLL VSDVGAHLGS SCGSSG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003565547.10.0PREDICTED: protein NLP3
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLA0A0E0BZP10.0A0A0E0BZP1_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0JG460.0A0A0E0JG46_ORYPU; Uncharacterized protein
STRINGORGLA01G0077900.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47783660
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.10.0Nin-like family protein